PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G01060.1
Common NameCPL3, ETC3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 77aa    MW: 8901 Da    PI: 5.7204
Description CAPRICE-like MYB3
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G01060.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.71.5e-093473344
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     ++++eE++l  + +k+ G + W++Ia +++ gRt+ ++  +w
      AT4G01060.1 34 NMSQEEEDLVSRMHKLVGDR-WELIAGRIP-GRTAGEIERFW 73
                     689***************99.*********.*******9999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007179.2E-43177IPR001005SANT/Myb domain
PfamPF002492.1E-83474IPR001005SANT/Myb domain
CDDcd001671.06E-63473No hitNo description
Gene3DG3DSA:1.10.10.608.4E-113574IPR009057Homeodomain-like
PROSITE profilePS500906.0053673IPR017877Myb-like domain
SuperFamilySSF466894.29E-73674IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010026Biological Processtrichome differentiation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000014anatomyrosette leaf
PO:0000293anatomyguard cell
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009046anatomyflower
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MDNHRRTKQP KTNSIVTSSS EGTEVSSLEW EVVNMSQEEE DLVSRMHKLV GDRWELIAGR  60
IPGRTAGEIE RFWVMKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.344828e-46flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO10535418e-46
Expression AtlasAT4G01060-
AtGenExpressAT4G01060-
Functional Description ? help Back to Top
Source Description
TAIREncodes a Myb-related protein similar to CPC. Involved in epidermal cell differentiation. Mutants have reduced numbers of root hairs and increased trichome branching. Involved in endoreduplication. Loss of function mutants are hypertrophic and early flowering.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G01060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G63650 (A), AT3G27920 (A), AT5G14750 (A), AT5G41315 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G01060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2642921e-128AB264292.1 Arabidopsis thaliana mRNA for CPL3, complete cds.
GenBankAK1180431e-128AK118043.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL19-27-F14.
GenBankBT0056111e-128BT005611.1 Arabidopsis thaliana clone U50786 putative myb family transcription factor (At4g01060) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192015.22e-50CAPRICE-like MYB3
SwissprotQ9M1575e-39ETC3_ARATH; MYB-like transcription factor ETC3
TrEMBLD7M4Z51e-48D7M4Z5_ARALL; Myb family transcription factor
STRINGAT4G01060.16e-50(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Representative plantOGRP4207823
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Wu XM,Lim SH,Yang WC
    Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid.
    Plant Mol. Biol., 2003. 51(6): p. 959-72
    [PMID:12777054]
  3. Kirik V,Simon M,Huelskamp M,Schiefelbein J
    The ENHANCER OF TRY AND CPC1 gene acts redundantly with TRIPTYCHON and CAPRICE in trichome and root hair cell patterning in Arabidopsis.
    Dev. Biol., 2004. 268(2): p. 506-13
    [PMID:15063185]
  4. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  5. Esch JJ,Chen MA,Hillestad M,Marks MD
    Comparison of TRY and the closely related At1g01380 gene in controlling Arabidopsis trichome patterning.
    Plant J., 2004. 40(6): p. 860-9
    [PMID:15584952]
  6. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  7. Tominaga R,Iwata M,Okada K,Wada T
    Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis.
    Plant Cell, 2007. 19(7): p. 2264-77
    [PMID:17644729]
  8. Simon M,Lee MM,Lin Y,Gish L,Schiefelbein J
    Distinct and overlapping roles of single-repeat MYB genes in root epidermal patterning.
    Dev. Biol., 2007. 311(2): p. 566-78
    [PMID:17931617]
  9. Wang S, et al.
    TRICHOMELESS1 regulates trichome patterning by suppressing GLABRA1 in Arabidopsis.
    Development, 2007. 134(21): p. 3873-82
    [PMID:17933793]
  10. Tominaga R, et al.
    Arabidopsis CAPRICE-LIKE MYB 3 (CPL3) controls endoreduplication and flowering development in addition to trichome and root hair formation.
    Development, 2008. 135(7): p. 1335-45
    [PMID:18305006]
  11. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  12. Wang S, et al.
    Comprehensive analysis of single-repeat R3 MYB proteins in epidermal cell patterning and their transcriptional regulation in Arabidopsis.
    BMC Plant Biol., 2008. 8: p. 81
    [PMID:18644155]
  13. Wester K, et al.
    Functional diversity of R3 single-repeat genes in trichome development.
    Development, 2009. 136(9): p. 1487-96
    [PMID:19336467]
  14. Rehrauer H, et al.
    AGRONOMICS1: a new resource for Arabidopsis transcriptome profiling.
    Plant Physiol., 2010. 152(2): p. 487-99
    [PMID:20032078]
  15. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  16. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  17. Tominaga-Wada R,Nukumizu Y
    Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis.
    Int J Mol Sci, 2012. 13(3): p. 3478-91
    [PMID:22489163]
  18. Tominaga-Wada R,Nukumizu Y,Sato S,Wada T
    Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor.
    PLoS ONE, 2013. 8(1): p. e54019
    [PMID:23326563]
  19. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]